Recombinant Mouse Siglec-15/CD33L3 Protein
Product Sizes
10 ug
£145.00
RP01290-10UG
20 ug
£193.00
RP01290-20UG
50 ug
£288.00
RP01290-50UG
100 ug
£431.00
RP01290-100UG
About this Product
- SKU:
- RP01290
- Additional Names:
- sialic acid-binding Ig-like lectin 15,CD33 antigen-like 3,SIGLEC15,Siglec15,SIGLEC15,sialic acid-binding Ig-like lectin 15,CD33 antigen-like 3,SIGLEC15,Siglec15,SIGLEC15
- Extra Details:
- Recombinant Mouse Siglec-15/CD33L3 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Arg24-Thr262) of mouse Siglec-15/CD33L3 (Accession #NP_001094508.1) fused with a Fc tag at the C-terminus.
- Formulation:
- Lyophilized from a 0.22 um filtered solution of PBS, pH 7.4.
- Immunogen:
- Arg24-Thr262
- Molecular Weight:
- 51.59 kDa
- Physical State:
- Lyophilized
- Purity:
- ≥90%
- Sequence:
- RRDASGDLLNTEAHSAPAQRWSMQVPAEVNAEAGDAAVLPCTFTHPHRHYDGPLTAIWRSGEPYAGPQVFRCTAAPGSELCQTALSLHGRFRLLGNPRRNDLSLRVERLALADSGRYFCRVEFTGDAHDRYESRHGVRLRVTAAAPRIVNISVLPGPAHAFRALCTAEGEPPPALAWSGPAPGNSSAALQGQGHGYQVTAELPALTRDGRYTCTAANSLGRAEASVYLFRFHGAPGTST
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Lectins
- Manufacturer's Data Sheet:RP01290
