Recombinant SARS-CoV-2 papain-like protease Protein
Product Sizes
10 ug
£133.00
RP01274LQ-10UG
100 ug
£353.00
RP01274LQ-100UG
500 ug
£1027.00
RP01274LQ-500UG
1000 ug
£2122.00
RP01274LQ-1000UG
About this Product
- SKU:
- RP01274LQ
- Additional Names:
- PLPro,PL-PRO,pp1a,Papain-like Protease,Replicase polyprotein 1a,ORF1a polyprotein,Plpro,COVID-19
- Extra Details:
- Recombinant SARS-CoV-2(2019-nCoV) papain-like protease is produced by E. coli expression system. The target protein is expressed with sequence (Glu1564-Lys1878) of SARS-COV-2(2019-nCoV) papain-like protease (Accession #YP_009725299.1) fused with an initial Met,a 6xHis tag at the N-terminus.
- Formulation:
- Recombinant SARS-CoV-2(2019-nCoV) papain-like protease is produced by E. coli expression system. The target protein is expressed with sequence (Glu1564-Lys1878) of SARS-COV-2(2019-nCoV) papain-like pr
- Immunogen:
- Glu1564-Lys1878
- Molecular Weight:
- 38 kDa
- Purity:
- ≥90%
- Sequence:
- EVRTIKVFTTVDNINLHTQVVDMSMTYGQQFGPTYLDGADVTKIKPHNSHEGKTFYVLPNDDTLRVEAFEYYHTTDPSFLGRYMSALNHTKKWKYPQVNGLTSIKWADNNCYLATALLTLQQIELKFNPPALQDAYYRARAGEAANFCALILAYCNKTVGELGDVRETMSYLFQHANLDSCKRVLNVVCKTCGQQQTTLKGVEAVMYMGTLSYEQFKKGVQIPCTCGKQATKYLVQQESPFVMMSAPPAQYELKHGTFTCASEYTGNYQCGHYKHITSKETLYCIDGALLTKSSEYKGPITDVFYKENSYTTTIK
- Shipping Conditions:
- Dry Ice
- Storage Conditions:
- -70[o]C Aliquot. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Enzymes
- Manufacturer's Data Sheet:RP01274LQ
