Recombinant SARS-CoV-2 Envelope Protein
Product Sizes
100 ug
£205.00
RP01263LQ-100UG
About this Product
- SKU:
- RP01263LQ
- Additional Names:
- 2019-nCoV E protein,2019-nCoV sM protein,Envelope protein,Env polyprotein,Envelope glycoprotein,env,COVID-19,E
- Extra Details:
- Recombinant SARS-CoV-2(2019-nCoV) Envelope Protein is produced by E. coli expression system. The target protein is expressed with sequence (Met1-Val75) of SARS-COV-2(2019-nCoV) Envelope (Accession #QHD43418.1) fused with an initial Met,a 6xHis,Avi tag at the N-terminus.
- Formulation:
- Supplied as a 0.22 um filtered solution in 20mM Tris,250mM NaCl,0.5%TritonX-100,pH 8.0.Contact us for customized product form or formulation.
- Immunogen:
- Met1-Val75
- Molecular Weight:
- 11.02 kDa
- Purity:
- ≥95%
- Sequence:
- MYSFVSEETGTLIVNSVLLFLAFVVFLLVTLAILTALRLCAYCCNIVNVSLVKPSFYVYSRVKNLNSSRVPDLLV
- Shipping Conditions:
- Dry Ice
- Storage Conditions:
- -70[o]C Aliquot. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Manufacturer's Data Sheet:RP01263LQ
