Recombinant Human CD8a Protein
Product Sizes
10 ug
£145.00
RP01245-10UG
50 ug
£288.00
RP01245-50UG
100 ug
£431.00
RP01245-100UG
About this Product
- SKU:
- RP01245
- Additional Names:
- CD8, Leu2, MAL, p32,CD8A,Leu2,MAL,p32
- Extra Details:
- Recombinant Human CD8a Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Ser22-Asp182) of human CD8 alpha (Accession #NP_001759.3) fused with a Fc, 6xHis tag at the C-terminus.
- Formulation:
- Lyophilized from a 0.22 um filtered solution of PBS, pH 7.4.Contact us for customized product form or formulation.
- Immunogen:
- Ser22-Asp182
- Molecular Weight:
- 44.40 kDa
- Physical State:
- Lyophilized
- Purity:
- ≥95%
- Sequence:
- SQFRVSPLDRTWNLGETVELKCQVLLSNPTSGCSWLFQPRGAAASPTFLLYLSQNKPKAAEGLDTQRFSGKRLGDTFVLTLSDFRRENEGYYFCSALSNSIMYFSHFVPVFLPAKPTTTPAPRPPTPAPTIASQPLSLRPEACRPAAGGAVHTRGLDFACD
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Manufacturer's Data Sheet:RP01245








