Recombinant Human Noggin/NOG Protein
Product Sizes
10 ug
£145.00
RP01237-10UG
20 ug
£193.00
RP01237-20UG
50 ug
£288.00
RP01237-50UG
100 ug
£431.00
RP01237-100UG
1000 ug
£1573.00
RP01237-1000UG
About this Product
- SKU:
- RP01237
- Additional Names:
- NOG,SYM1,SYNS1,SYNS1A,noggin
- Extra Details:
- Recombinant Human Noggin/NOG Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Gln28-Cys232) of human Noggin (Accession #NP_005441.1) fused with a 6xHis tag at the C-terminus.
- Formulation:
- Lyophilized from a 0.22 um filtered solution of PBS, pH 7.4.Contact us for customized product form or formulation.
- Immunogen:
- Gln28-Cys232
- Molecular Weight:
- 23.89 kDa
- Physical State:
- Lyophilized
- Purity:
- ≥95%
- Sequence:
- QHYLHIRPAPSDNLPLVDLIEHPDPIFDPKEKDLNETLLRSLLGGHYDPGFMATSPPEDRPGGGGGAAGGAEDLAELDQLLRQRPSGAMPSEIKGLEFSEGLAQGKKQRLSKKLRRKLQMWLWSQTFCPVLYAWNDLGSRFWPRYVKVGSCFSKRSCSVPEGMVCKPSKSVHLTVLRWRCQRRGGQRCGWIPIQYPIISECKCSC
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Manufacturer's Data Sheet:RP01237










