Recombinant Mouse B7-2/CD86 Protein
Product Sizes
10 ug
£127.00
RP01234-10UG
20 ug
£157.00
RP01234-20UG
50 ug
£223.00
RP01234-50UG
100 ug
£336.00
RP01234-100UG
500 ug
£937.00
RP01234-500UG
1000 ug
£1478.00
RP01234-1000UG
About this Product
- SKU:
- RP01234
- Additional Names:
- CD86,B7-2,B70,CD28LG2,LAB72,MGC34413,CD86,CD86,B7-2,B70,CD28LG2,LAB72,MGC34413,CD86
- Extra Details:
- CD86, also known as B-lymphocyte activation antigen B7-2 (referred to as B70), is a member of the cell surface immunoglobulin superfamily. CD86 is expressed by antigen-presenting cells, and it is the ligand for two proteins at the cell surface of T cells, CD28 antigen and cytotoxic T-lymphocyte-associated protein 4. Binding of this protein with CD28 antigen is a costimulatory signal for activation of the T-cell. Binding of this protein with cytotoxic T-lymphocyte-associated protein 4 negatively regulates T-cell activation and diminishes the immune response.
- Formulation:
- Recombinant Mouse B7-2/CD86 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Val24-Glu245) of mouse CD86/B7-2 (Accession #NP_062261.3) fused with a
- Immunogen:
- Val24-Glu245
- Molecular Weight:
- 35-55 kDa
- Physical State:
- Lyophilized
- Purity:
- ≥ 95 % as determined by SDS-PAGE;≥ 90 %
- Sequence:
- VSVETQAYFNGTAYLPCPFTKAQNISLSELVVFWQDQQKLVLYEHYLGTEKLDSVNAKYLGRTSFDRNNWTLRLHNVQIKDMGSYDCFIQKKPPTGSIILQQTLTELSVIANFSEPEIKLAQNVTGNSGINLTCTSKQGHPKPKKMYFLITNSTNEYGDNMQISQDNVTELFSISNSLSLSFPDGVWHMTVVCVLETESMKISSKPLNFTQEFPSPQTYWKE
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Manufacturer's Data Sheet:RP01234
