Recombinant Mouse B7-1/CD80 Protein
Product Sizes
10 ug
£127.00
RP01230-10UG
20 ug
£157.00
RP01230-20UG
50 ug
£223.00
RP01230-50UG
100 ug
£336.00
RP01230-100UG
About this Product
- SKU:
- RP01230
- Additional Names:
- B7,B7-1,B7.1,BB1,CD28LG,CD28LG1,LAB7,CD80,B7,B7-1,B7.1,BB1,CD28LG,CD28LG1,LAB7,CD80
- Extra Details:
- Recombinant Mouse B7-1/CD80 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Val38-Lys245) of mouse B7-1/CD80 (Accession #NP_033985.3) fused with a 6xHis tag at the C-terminus.
- Formulation:
- Lyophilized from a 0.22 um filtered solution of PBS, pH 7.4.Contact us for customized product form or formulation.
- Immunogen:
- Val38-Lys245
- Molecular Weight:
- 24.52 kDa
- Physical State:
- Lyophilized
- Purity:
- ≥90%
- Sequence:
- VDEQLSKSVKDKVLLPCRYNSPHEDESEDRIYWQKHDKVVLSVIAGKLKVWPEYKNRTLYDNTTYSLIILGLVLSDRGTYSCVVQKKERGTYEVKHLALVKLSIKADFSTPNITESGNPSADTKRITCFASGGFPKPRFSWLENGRELPGINTTISQDPESELYTISSQLDFNTTRNHTIKCLIKYGDAHVSEDFTWEKPPEDPPDSK
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Manufacturer's Data Sheet:RP01230
