Recombinant Human CD24 Protein
Product Sizes
10 ug
£127.00
RP01229-10UG
20 ug
£175.00
RP01229-20UG
50 ug
£240.00
RP01229-50UG
About this Product
- SKU:
- RP01229
- Additional Names:
- CD24,CD24A,CD24 molecule,CD247
- Extra Details:
- Recombinant Human CD24 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Met1-Gly59) of human CD24 (Accession #NP_037362) fused with a Fc tag at the C-terminus.
- Formulation:
- Lyophilized from a 0.22 um filtered solution of PBS, pH 7.4.Contact us for customized product form or formulation.
- Immunogen:
- Met1-Gly59
- Molecular Weight:
- 31.85 kDa
- Physical State:
- Lyophilized
- Purity:
- ≥ 95 % as determined by SDS-PAGE;≥95 %
- Sequence:
- MGRAMVARLGLGLLLLALLLPTQIYSSETTTGTSSNSSQSTSNSGLAPNPTNATTKAAG
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Manufacturer's Data Sheet:RP01229
