Recombinant Rat Lipocalin-2/NGAL/LCN2 Protein
Product Sizes
10 ug
£133.00
RP01225-10UG
20 ug
£181.00
RP01225-20UG
50 ug
£240.00
RP01225-50UG
100 ug
£353.00
RP01225-100UG
About this Product
- SKU:
- RP01225
- Additional Names:
- NGAL,LCN2,Lipocalin-2,24p3,MSFI,LCN2
- Extra Details:
- Recombinant Rat Lipocalin-2/NGAL/LCN2 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Gln21-Asn198) of rat Lipocalin-2/NGAL (Accession #NP_570097.1.) fused with a 6xHis tag at the C-terminus.
- Formulation:
- Lyophilized from a 0.22 um filtered solution of 20mM Tris,500mM NaCl, pH 7.0Contact us for customized product form or formulation.
- Immunogen:
- Gln21-Asn198
- Molecular Weight:
- 21.34 kDa
- Physical State:
- Lyophilized
- Purity:
- ≥95%
- Sequence:
- QDSTQNLIPAPPLISVPLQPGFWTERFQGRWFVVGLAANAVQKERQSRFTMYSTIYELQEDNSYNVTSILVRGQGCRYWIRTFVPSSRPGQFTLGNIHSYPQIQSYDVQVADTDYDQFAMVFFQKTSENKQYFKVTLYGRTKGLSDELKERFVSFAKSLGLKDNNIVFSVPTDQCIDN
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Manufacturer's Data Sheet:RP01225
