Recombinant Mouse CSF-1/M-CSF Protein
Product Sizes
10 ug
£193.00
RP01216S-10UG
20 ug
£258.00
RP01216S-20UG
50 ug
£383.00
RP01216S-50UG
100 ug
£586.00
RP01216S-100UG
500 ug
£1716.00
RP01216S-500UG
1000 ug
£2716.00
RP01216S-1000UG
About this Product
- SKU:
- RP01216S
- Additional Names:
- MCSF,M-CSF,CSF-1,Lanimostim,CSF1
- Extra Details:
- Macrophage colony-stimulating factor 1, also known as CSF-1, M-CSF, is a single-pass membrane protein which is disulfide-linked as a homodimer or heterodimer. Granulocyte / macrophage colony-stimulating factors are cytokines that act in hematopoiesis by controlling the production, differentiation, and function of 2 related white cell populations of the blood, the granulocytes and the monocytes-macrophages. M-CSF/CSF-1 is known to facilitate monocyte survival, monocyte-to-macrophage conversion, and macrophage proliferation. M-CSF/CSF-1 is a secreted cytokine which influences hemopoietic stem cells to differentiate into macrophages or other related cell types. It binds to the Colony stimulating factor 1 receptor. M-CSF/CSF-1 may also be involved in development of the placenta. The active form of M-CSF/CSF-1 is found extracellularly as a disulfide-linked homodimer, and is thought to be produced by proteolytic cleavage of membrane-bound precursors. M-CSF/CSF-1 induces cells of the monocyte/macrophage lineage. It
- Formulation:
- Recombinant Mouse CSF-1/M-CSF Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Met1-Pro187) of Mouse CSF-1/M-CSF (Accession #NP_031804.3.) fused
- Immunogen:
- Met1-Pro187
- Molecular Weight:
- 20-25 kDa
- Physical State:
- Lyophilized
- Purity:
- ≥95%
- Sequence:
- MTARGAAGRCPSSTWLGSRLLLVCLLMSRSIAKEVSEHCSHMIGNGHLKVLQQLIDSQMETSCQIAFEFVDQEQLDDPVCYLKKAFFLVQDIIDETMRFKDNTPNANATERLQELSNNLNSCFTKDYEEQNKACVRTFHETPLQLLEKIKNFFNETKNLLEKDWNIFTKNCNNSFAKCSSRDVVTKP
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Manufacturer's Data Sheet:RP01216S
