Recombinant Mouse CD28 Protein
Product Sizes
10 ug
£127.00
RP01211-10UG
20 ug
£157.00
RP01211-20UG
50 ug
£223.00
RP01211-50UG
100 ug
£336.00
RP01211-100UG
About this Product
- SKU:
- RP01211
- Additional Names:
- CD28,Tp44,CD28
- Extra Details:
- Recombinant Mouse CD28 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Asn20-Lys149) of mouse CD28 (Accession #NP_031668.3) fused with a Fc, 6xHis tag at the C-terminus.
- Formulation:
- Lyophilized from a 0.22 um filtered solution of PBS, pH 7.4.Contact us for customized product form or formulation.
- Immunogen:
- Asn20-Lys149
- Molecular Weight:
- 41.84 kDa
- Physical State:
- Lyophilized
- Purity:
- ≥95%
- Sequence:
- NKILVKQSPLLVVDSNEVSLSCRYSYNLLAKEFRASLYKGVNSDVEVCVGNGNFTYQPQFRSNAEFNCDGDFDNETVTFRLWNLHVNHTDIYFCKIEFMYPPPYLDNERSNGTIIHIKEKHLCHTQSSPK
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Manufacturer's Data Sheet:RP01211
