Recombinant Human ROR1 Protein
Product Sizes
10 ug
£115.00
RP01208-10UG
20 ug
£145.00
RP01208-20UG
50 ug
£193.00
RP01208-50UG
100 ug
£276.00
RP01208-100UG
About this Product
- SKU:
- RP01208
- Additional Names:
- ROR1,NTRKR1,dJ537F10.1
- Extra Details:
- Recombinant Human ROR1 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Gln30-Glu403) of human ROR1 (Accession #NP_005003.2) fused with a Fc, 6xHis tag at the C-terminus.
- Formulation:
- Lyophilized from a 0.22 um filtered solution of PBS, pH 7.4.Contact us for customized product form or formulation.
- Immunogen:
- Gln30-Glu403
- Molecular Weight:
- 68.77 kDa
- Physical State:
- Lyophilized
- Purity:
- ≥95%
- Sequence:
- QETELSVSAELVPTSSWNISSELNKDSYLTLDEPMNNITTSLGQTAELHCKVSGNPPPTIRWFKNDAPVVQEPRRLSFRSTIYGSRLRIRNLDTTDTGYFQCVATNGKEVVSSTGVLFVKFGPPPTASPGYSDEYEEDGFCQPYRGIACARFIGNRTVYMESLHMQGEIENQITAAFTMIGTSSHLSDKCSQFAIPSLCHYAFPYCDETSSVPKPRDLCRDECEILENVLCQTEYIFARSNPMILMRLKLPNCEDLPQPESPEAANCIRIGIPMADPINKNHKCYNSTGVDYRGTVSVTKSGRQCQPWNSQYPHTHTFTALRFPELNGGHSYCRNPGNQKEAPWCFTLDENFKSDLCDIPACDSKDSKEKNKME
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Enzymes
- Manufacturer's Data Sheet:RP01208
