Recombinant Mouse CSF-2/GM-CSF Protein
Product Sizes
10 ug
£145.00
RP01206-10UG
20 ug
£193.00
RP01206-20UG
50 ug
£288.00
RP01206-50UG
100 ug
£431.00
RP01206-100UG
About this Product
- SKU:
- RP01206
- Additional Names:
- GMCSF,CSF2
- Extra Details:
- Recombinant Mouse CSF-2/GM-CSF Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Ala18-Lys141) of mouse GM-CSF/CSF2 (Accession #NP_034099.2) fused with a 6xHis tag at the N-terminus.
- Formulation:
- Lyophilized from a 0.22 um filtered solution of PBS, pH 7.4.Contact us for customized product form or formulation.
- Immunogen:
- Ala18-Lys141
- Molecular Weight:
- 14.95 kDa
- Physical State:
- Lyophilized
- Purity:
- ≥ 95 % as determined by SDS-PAGE;≥ 90 %
- Sequence:
- APTRSPITVTRPWKHVEAIKEALNLLDDMPVTLNEEVEVVSNEFSFKKLTCVQTRLKIFEQGLRGNFTKLKGALNMTASYYQTYCPPTPETDCETQVTTYADFIDSLKTFLTDIPFECKKPGQK
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Manufacturer's Data Sheet:RP01206










