Recombinant Human IL-15RA/CD215 Protein
Product Sizes
10 ug
£145.00
RP01192-10UG
20 ug
£193.00
RP01192-20UG
50 ug
£288.00
RP01192-50UG
100 ug
£395.00
RP01192-100UG
About this Product
- SKU:
- RP01192
- Additional Names:
- IL15RA,CD215
- Extra Details:
- Recombinant Human IL-15RA/CD215 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Met1-Thr205) of human IL-15R alpha/CD215 (Accession #NP_002180.1) fused with a Fc, 6xHis tag at the C-terminus.
- Formulation:
- Lyophilized from a 0.22 um filtered solution of PBS, pH 7.4.Contact us for customized product form or formulation.
- Immunogen:
- Met1-Thr205
- Molecular Weight:
- 48.40 kDa
- Physical State:
- Lyophilized
- Purity:
- ≥95%
- Sequence:
- MAPRRARGCRTLGLPALLLLLLLRPPATRGITCPPPMSVEHADIWVKSYSLYSRERYICNSGFKRKAGTSSLTECVLNKATNVAHWTTPSLKCIRDPALVHQRPAPPSTVTTAGVTPQPESLSPSGKEPAASSPSSNNTAATTAAIVPGSQLMPSKSPSTGTTEISSHESSHGTPSQTTAKNWELTASASHQPPGVYPQGHSDTT
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Manufacturer's Data Sheet:RP01192
