Recombinant Human LYPD3 Protein
Product Sizes
10 ug
£127.00
RP01190-10UG
20 ug
£175.00
RP01190-20UG
50 ug
£240.00
RP01190-50UG
100 ug
£336.00
RP01190-100UG
About this Product
- SKU:
- RP01190
- Additional Names:
- LYPD3,C4.4A
- Extra Details:
- Recombinant Human LYPD3 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Leu31-His286) of human LYPD3/C4.4A (Accession #NP_055215.2.) fused with a 6xHis tag at the C-terminus.
- Formulation:
- Lyophilized from a 0.22 um filtered solution of PBS, pH 7.4.Contact us for customized product form or formulation.
- Immunogen:
- Leu31-His286
- Molecular Weight:
- 27.69 kDa
- Physical State:
- Lyophilized
- Purity:
- ≥95%
- Sequence:
- LECYSCVQKADDGCSPNKMKTVKCAPGVDVCTEAVGAVETIHGQFSLAVRGCGSGLPGKNDRGLDLHGLLAFIQLQQCAQDRCNAKLNLTSRALDPAGNESAYPPNGVECYSCVGLSREACQGTSPPVVSCYNASDHVYKGCFDGNVTLTAANVTVSLPVRGCVQDEFCTRDGVTGPGFTLSGSCCQGSRCNSDLRNKTYFSPRIPPLVRLPPPEPTTVASTTSVTTSTSAPVRPTSTTKPMPAPTSQTPRQGVEH
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Manufacturer's Data Sheet:RP01190








