Recombinant Human LOX-1/OLR1 Protein
Product Sizes
10 ug
£127.00
RP01189-10UG
20 ug
£175.00
RP01189-20UG
50 ug
£240.00
RP01189-50UG
About this Product
- SKU:
- RP01189
- Additional Names:
- OLR1,CLEC8A,LOX1,LOXIN,SCARE1,SLOX1
- Extra Details:
- Recombinant Human LOX-1/OLR1 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Ser61-Gln273) of human LOX-1/OLR1 (Accession #NP_002534.1) fused with a 6xHis tag at the C-terminus.
- Formulation:
- Lyophilized from a 0.22 um filtered solution of PBS, pH 7.4.Contact us for customized product form or formulation.
- Immunogen:
- Ser61-Gln273
- Molecular Weight:
- 25.18 kDa
- Physical State:
- Lyophilized
- Purity:
- ≥85%
- Sequence:
- SQVSDLLTQEQANLTHQKKKLEGQISARQQAEEASQESENELKEMIETLARKLNEKSKEQMELHHQNLNLQETLKRVANCSAPCPQDWIWHGENCYLFSSGSFNWEKSQEKCLSLDAKLLKINSTADLDFIQQAISYSSFPFWMGLSRRNPSYPWLWEDGSPLMPHLFRVRGAVSQTYPSGTCAYIQRGAVYAENCILAAFSICQKKANLRAQ
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Manufacturer's Data Sheet:RP01189
