Recombinant Human Siglec-15/CD33L3 Protein
Product Sizes
10 ug
£133.00
RP01187-10UG
20 ug
£181.00
RP01187-20UG
100 ug
£353.00
RP01187-100UG
500 ug
£1002.00
RP01187-500UG
1000 ug
£1574.00
RP01187-1000UG
About this Product
- SKU:
- RP01187
- Additional Names:
- CD33L3, HsT1361, SIGLEC-15,SIGLEC15,Siglec-15
- Extra Details:
- Recombinant Human Siglec-15/CD33L3 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Phe20-Thr263) of human Siglec-15/CD33L3 (Accession #NP_998767.1) fused with a Fc, 6xHis tag at the C-terminus.
- Formulation:
- Recombinant Human Siglec-15/CD33L3 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Phe20-Thr263) of human Siglec-15/CD33L3 (Accession #NP_998767.1
- Immunogen:
- Phe20-Thr263
- Molecular Weight:
- 60-70 kDa
- Physical State:
- Lyophilized
- Purity:
- ≥ 95 % as determined by SDS-PAGE;≥95 %
- Sequence:
- FVRTKIDTTENLLNTEVHSSPAQRWSMQVPPEVSAEAGDAAVLPCTFTHPHRHYDGPLTAIWRAGEPYAGPQVFRCAAARGSELCQTALSLHGRFRLLGNPRRNDLSLRVERLALADDRRYFCRVEFAGDVHDRYESRHGVRLHVTAAPRIVNISVLPSPAHAFRALCTAEGEPPPALAWSGPALGNSLAAVRSPREGHGHLVTAELPALTHDGRYTCTAANSLGRSEASVYLFRFHGASGAST
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Lectins
- Manufacturer's Data Sheet:RP01187


