Recombinant Human NovH/CCN3(N97K) Protein
Product Sizes
10 ug
£145.00
RP01186-10UG
50 ug
£288.00
RP01186-50UG
100 ug
£431.00
RP01186-100UG
About this Product
- SKU:
- RP01186
- Additional Names:
- NOV,CCN3,IBP-9,IGFBP-9,IGFBP9,NOVh
- Extra Details:
- Recombinant Human NovH/CCN3(N97K) Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Thr32-Met357(Asn97Lys)) of human NOV/CCN3 (Accession #NP_002505.1) fused with a 6xHis tag at the C-terminus.
- Formulation:
- Lyophilized from a 0.22 um filtered solution of PBS, pH 7.4.Contact us for customized product form or formulation.
- Immunogen:
- Thr32-Met357(N97K)
- Molecular Weight:
- 36.58 kDa
- Physical State:
- Lyophilized
- Purity:
- ≥90%
- Sequence:
- TQRCPPQCPGRCPATPPTCAPGVRAVLDGCSCCLVCARQRGESCSDLEPCDESSGLYCDRSADPSKQTGICTAVEGDNCVFDGVIYRSGEKFQPSCKFQCTCRDGQIGCVPRCQLDVLLPEPNCPAPRKVEVPGECCEKWICGPDEEDSLGGLTLAAYRPEATLGVEVSDSSVNCIEQTTEWTACSKSCGMGFSTRVTNRNRQCEMLKQTRLCMVRPCEQEPEQPTDKKGKKCLRTKKSLKAIHLQFKNCTSLHTYKPRFCGVCSDGRCCTPHNTKTIQAEFQCSPGQIVKKPVMVIGTCTCHTNCPKNNEAFLQELELKTTRGKM
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Manufacturer's Data Sheet:RP01186
