Recombinant Human TNFRSF3/TNFR-III/LTBR Protein
Product Sizes
10 ug
£107.00
RP01179-10UG
20 ug
£133.00
RP01179-20UG
50 ug
£163.00
RP01179-50UG
100 ug
£240.00
RP01179-100UG
About this Product
- SKU:
- RP01179
- Additional Names:
- LTBR,CD18,D12S370,LT-BETA-R,TNF-R-III,TNFCR,TNFR-RP,TNFR2-RP,TNFR3,TNFRSF3
- Extra Details:
- Recombinant Human TNFRSF3/TNFR-III/LTBR Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Gln31-Met227) of human LTBR/TNFRSF3 (Accession #NP_002333.1) fused with an Fc, 6xHis tag at the C-terminus.
- Formulation:
- Lyophilized from a 0.22 um filtered solution of PBS, pH 7.4.Contact us for customized product form or formulation.
- Immunogen:
- Gln31-Met227
- Molecular Weight:
- 48.54 kDa
- Physical State:
- Lyophilized
- Purity:
- ≥95%
- Sequence:
- QAVPPYASENQTCRDQEKEYYEPQHRICCSRCPPGTYVSAKCSRIRDTVCATCAENSYNEHWNYLTICQLCRPCDPVMGLEEIAPCTSKRKTQCRCQPGMFCAAWALECTHCELLSDCPPGTEAELKDEVGKGNNHCVPCKAGHFQNTSSPSARCQPHTRCENQGLVEAAPGTAQSDTTCKNPLEPLPPEMSGTMLM
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Manufacturer's Data Sheet:RP01179








