Recombinant Human CD3 epsilon Protein
Product Sizes
10 ug
£145.00
RP01178-10UG
20 ug
£193.00
RP01178-20UG
50 ug
£264.00
RP01178-50UG
100 ug
£395.00
RP01178-100UG
About this Product
- SKU:
- RP01178
- Additional Names:
- CD3E,IMD18,T3E,TCRE,CD3e molecule
- Extra Details:
- Recombinant Human CD3 epsilon Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Met1-Asp126) of Human CD3 epsilon (Accession #NP_000724.1) fused with a 6xHis tag at the C-terminus.
- Formulation:
- Lyophilized from a 0.22 um filtered solution of PBS, pH 7.4.Contact us for customized product form or formulation.
- Immunogen:
- Met1-Asp126
- Molecular Weight:
- 15.00 kDa
- Physical State:
- Lyophilized
- Purity:
- ≥90%
- Sequence:
- MQSGTHWRVLGLCLLSVGVWGQDGNEEMGGITQTPYKVSISGTTVILTCPQYPGSEILWQHNDKNIGGDEDDKNIGSDEDHLSLKEFSELEQSGYYVCYPRGSKPEDANFYLYLRARVCENCMEMD
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Manufacturer's Data Sheet:RP01178
