Recombinant Mouse PD-1/PDCD1/CD279 Protein
Product Sizes
10 ug
£115.00
RP01177-10UG
20 ug
£145.00
RP01177-20UG
500 ug
£764.00
RP01177-500UG
1000 ug
£1193.00
RP01177-1000UG
About this Product
- SKU:
- RP01177
- Additional Names:
- CD279,mPD-1,SLEB2,PDCD1,PD1,PD1/CD279/PDCD1,CD279,mPD-1,SLEB2,PDCD1,PD1,PD1/CD279/PDCD1
- Extra Details:
- Recombinant Mouse PD-1/PDCD1/CD279 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Leu25-Gln167) of mouse PD-1 (Accession #NP_032824.1) fused with an Fc tag at the C-terminus.
- Formulation:
- Recombinant Mouse PD-1/PDCD1/CD279 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Leu25-Gln167) of mouse PD-1 (Accession #NP_032824.1) fused with
- Immunogen:
- Leu25-Gln167
- Molecular Weight:
- 55-70 kDa
- Physical State:
- Lyophilized
- Purity:
- ≥95%
- Sequence:
- LEVPNGPWRSLTFYPAWLTVSEGANATFTCSLSNWSEDLMLNWNRLSPSNQTEKQAAFCNGLSQPVQDARFQIIQLPNRHDFHMNILDTRRNDSGIYLCGAISLHPKAKIEESPGAELVVTERILETSTRYPSPSPKPEGRFQ
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Manufacturer's Data Sheet:RP01177
