Recombinant Human Flt4 ligand/VEGF-C Protein
Product Sizes
50 ug
£240.00
RP01173-50UG
About this Product
- SKU:
- RP01173
- Additional Names:
- VEGFC,Flt4-L,LMPH1D,VRP
- Extra Details:
- Recombinant Human Flt4 ligand/VEGF-C Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Thr103-Arg227) of human VEGF-C/Flt4-L/VRP (Accession #NP_005420.1) fused with a 6xHis tag at the C-terminus.
- Formulation:
- Lyophilized from a 0.22 um filtered solution of PBS, pH 7.4.Contact us for customized product form or formulation.
- Immunogen:
- Thr103-Arg227
- Molecular Weight:
- 14.93 kDa
- Physical State:
- Lyophilized
- Purity:
- ≥90%
- Sequence:
- TEETIKFAAAHYNTEILKSIDNEWRKTQCMPREVCIDVGKEFGVATNTFFKPPCVSVYRCGGCCNSEGLQCMNTSTSYLSKTLFEITVPLSQGPKPVTISFANHTSCRCMSKLDVYRQVHSIIRR
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Manufacturer's Data Sheet:RP01173








