Recombinant Mouse PD-1/PDCD1/CD279 Protein
Product Sizes
20 ug
£145.00
RP01170-20UG
50 ug
£193.00
RP01170-50UG
100 ug
£276.00
RP01170-100UG
About this Product
- SKU:
- RP01170
- Additional Names:
- CD279,mPD-1,SLEB2,PDCD1,PD1,PD1/CD279/PDCD1,CD279,mPD-1,SLEB2,PDCD1,PD1,PD1/CD279/PDCD1
- Extra Details:
- Recombinant Mouse PD-1/PDCD1/CD279 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Leu25-Gln167) of mouse PD-1 (Accession #NP_032824.1) fused with a 6xHis tag at the C-terminus.
- Formulation:
- Lyophilized from a 0.22 um filtered solution of PBS, pH 7.4.Contact us for customized product form or formulation.
- Immunogen:
- Leu25-Gln167
- Molecular Weight:
- 16.99 kDa
- Physical State:
- Lyophilized
- Purity:
- ≥95%
- Sequence:
- LEVPNGPWRSLTFYPAWLTVSEGANATFTCSLSNWSEDLMLNWNRLSPSNQTEKQAAFCNGLSQPVQDARFQIIQLPNRHDFHMNILDTRRNDSGIYLCGAISLHPKAKIEESPGAELVVTERILETSTRYPSPSPKPEGRFQ
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Manufacturer's Data Sheet:RP01170
