Recombinant Human/Mouse/Rat Irisin/FNDC5 Protein
Product Sizes
10 ug
£145.00
RP01164-10UG
20 ug
£193.00
RP01164-20UG
50 ug
£288.00
RP01164-50UG
100 ug
£431.00
RP01164-100UG
About this Product
- SKU:
- RP01164
- Additional Names:
- FRCP2,irisin,FNDC5
- Extra Details:
- Recombinant Human/Mouse/Rat Irisin/FNDC5 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Asp32-Glu143) of Human/Mouse/Rat Irisin (Accession #NP_715637.2) fused with a 6xHis tag at the C-terminus.
- Formulation:
- Lyophilized from a 0.22 um filtered solution of PBS, pH 7.4.Contact us for customized product form or formulation.
- Immunogen:
- Asp32-Glu143
- Molecular Weight:
- 13.43 kDa
- Physical State:
- Lyophilized
- Purity:
- ≥ 95 % as determined by SDS-PAGE;≥ 90 %
- Sequence:
- DSPSAPVNVTVRHLKANSAVVSWDVLEDEVVIGFAISQQKKDVRMLRFIQEVNTTTRSCALWDLEEDTEYIVHVQAISIQGQSPASEPVLFKTPREAEKMASKNKDEVTMKE
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Manufacturer's Data Sheet:RP01164
