Recombinant Human B7-H2/ICOSLG/CD275 Protein
Product Sizes
50 ug
£288.00
RP01163-50UG
100 ug
£431.00
RP01163-100UG
About this Product
- SKU:
- RP01163
- Additional Names:
- ICOSLG,B7-H2,B7H2,B7RP-1,B7RP1,CD275,GL50,ICOS-L,ICOSL,LICOS
- Extra Details:
- Recombinant Human B7-H2/ICOSLG/CD275 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Asp19-Ser258) of human B7-H2/ICOSLG (Accession #NP_056074.1) fused with a 6xHis tag at the C-terminus.
- Formulation:
- Lyophilized from a 0.22 um filtered solution of PBS, pH 7.4.Contact us for customized product form or formulation.
- Immunogen:
- Asp19-Ser258
- Molecular Weight:
- 27.53 kDa
- Physical State:
- Lyophilized
- Purity:
- ≥90%
- Sequence:
- DTQEKEVRAMVGSDVELSCACPEGSRFDLNDVYVYWQTSESKTVVTYHIPQNSSLENVDSRYRNRALMSPAGMLRGDFSLRLFNVTPQDEQKFHCLVLSQSLGFQEVLSVEVTLHVAANFSVPVVSAPHSPSQDELTFTCTSINGYPRPNVYWINKTDNSLLDQALQNDTVFLNMRGLYDVVSVLRIARTPSVNIGCCIENVLLQQNLTVGSQTGNDIGERDKITENPVSTGEKNAATWS
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Manufacturer's Data Sheet:RP01163
