Recombinant Human VEGF-A/VEGF121 Protein
Product Sizes
10 ug
£145.00
RP01162-10UG
20 ug
£193.00
RP01162-20UG
50 ug
£288.00
RP01162-50UG
100 ug
£431.00
RP01162-100UG
500 ug
£1240.00
RP01162-500UG
1000 ug
£1954.00
RP01162-1000UG
About this Product
- SKU:
- RP01162
- Additional Names:
- VEGFA, MVCD1, VEGF, VPF, vascular endothelial growth factor A,MVCD1,VEGF,VPF,L VEGFA,VEGF A
- Extra Details:
- This protein is a member of the PDGF/VEGF growth factor family. It encodes a heparin-binding protein, which exists as a disulfide-linked homodimer. This growth factor induces proliferation and migration of vascular endothelial cells, and is essential for both physiological and pathological angiogenesis. Disruption of this gene in mice resulted in abnormal embryonic blood vessel formation. This protein is upregulated in many known tumors and its expression is correlated with tumor stage and progression. Elevated levels of this protein are found in patients with POEMS syndrome, also known as Crow-Fukase syndrome.
- Formulation:
- Recombinant Human VEGF-A/VEGF121 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Ala27-Arg147) of human VEGF121 (Accession #NP_001165099.1) fused
- Immunogen:
- Ala27-Arg147
- Molecular Weight:
- 17-22 kDa
- Physical State:
- Lyophilized
- Purity:
- ≥95%
- Sequence:
- APMAEGGGQNHHEVVKFMDVYQRSYCHPIETLVDIFQEYPDEIEYIFKPSCVPLMRCGGCCNDEGLECVPTEESNITMQIMRIKPHQGQHIGEMSFLQHNKCECRPKKDRARQEKCDKPRR
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Manufacturer's Data Sheet:RP01162


