Recombinant Human TREM2 Protein
Product Sizes
10 ug
£133.00
RP01159-10UG
20 ug
£181.00
RP01159-20UG
50 ug
£240.00
RP01159-50UG
500 ug
£1002.00
RP01159-500UG
1000 ug
£1574.00
RP01159-1000UG
About this Product
- SKU:
- RP01159
- Additional Names:
- PLOSL2, TREM-2, Trem2a, Trem2b, Trem2c,TREM2,TREM-2,Trem2a,Trem2b,Trem2c
- Extra Details:
- Recombinant Human TREM2 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (His19-Ser174) of human TREM-2 (Accession #NP_061838) fused with a 6xHis tag at the C-terminus.
- Formulation:
- Recombinant Human TREM2 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (His19-Ser174) of human TREM-2 (Accession #NP_061838) fused with a 6xHis ta
- Immunogen:
- His19-Ser174
- Molecular Weight:
- 25-39 kDa
- Physical State:
- Lyophilized
- Purity:
- ≥95%
- Sequence:
- HNTTVFQGVAGQSLQVSCPYDSMKHWGRRKAWCRQLGEKGPCQRVVSTHNLWLLSFLRRWNGSTAITDDTLGGTLTITLRNLQPHDAGLYQCQSLHGSEADTLRKVLVEVLADPLDHRDAGDLWFPGESESFEDAHVEHSISRSLLEGEIPFPPTS
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Manufacturer's Data Sheet:RP01159


