Recombinant Mouse TIM-3/HAVCR2/CD366 Protein
Product Sizes
10 ug
£127.00
RP01152-10UG
20 ug
£157.00
RP01152-20UG
50 ug
£223.00
RP01152-50UG
100 ug
£336.00
RP01152-100UG
500 ug
£907.00
RP01152-500UG
1000 ug
£1478.00
RP01152-1000UG
About this Product
- SKU:
- RP01152
- Additional Names:
- Tim, TIM-, Tim3, Timd, TIM-3, Timd3,HAVCR2
- Extra Details:
- HAVCR2 also known as TIM3(T cell immunoglobulin and mucin domain-3) is belongs to the immunoglobulin superfamily, and TIM family of proteins. CD4-positive T helper lymphocytes can be divided into types 1 (Th1) and 2 (Th2) on the basis of their cytokine secretion patterns. Th1 cells are involved in cell-mediated immunity to intracellular pathogens and delayed-type hypersensitivity reactions, whereas, Th2 cells are involved in the control of extracellular helminthic infections and the promotion of atopic and allergic diseases. This protein is a Th1-specific cell surface protein that regulates macrophage activation, and inhibits Th1-mediated auto- and alloimmune responses, and promotes immunological tolerance. Its binding to Galectin-9 induces a range of immunosuppressive functions which enhance immune tolerance and inhibit anti-tumor immunity .
- Formulation:
- Recombinant Mouse TIM-3/HAVCR2/CD366 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Arg20-Arg191) of mouse TIM-3 (Accession #NP_599011.2) fused w
- Immunogen:
- Arg20-Arg191
- Molecular Weight:
- 38-55 kDa
- Physical State:
- Lyophilized
- Purity:
- ≥95%
- Sequence:
- RSLENAYVFEVGKNAYLPCSYTLSTPGALVPMCWGKGFCPWSQCTNELLRTDERNVTYQKSSRYQLKGDLNKGDVSLIIKNVTLDDHGTYCCRIQFPGLMNDKKLELKLDIKAAKVTPAQTAHGDSTTASPRTLTTERNGSETQTLVTLHNNNGTKISTWADEIKDSGETIR
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Manufacturer's Data Sheet:RP01152
