Recombinant Mouse IL-17F Protein
Product Sizes
10 ul
£133.00
RP01147-10UL
20 ug
£181.00
RP01147-20UG
50 ul
£240.00
RP01147-50UL
100 ul
£353.00
RP01147-100UL
About this Product
- SKU:
- RP01147
- Additional Names:
- IL17F,IL24,ML-1,Interleukin-17F,IL17F
- Extra Details:
- Recombinant Mouse IL-17F Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Met1-Ala161) of mouse IL-17F (Accession #NP_665855.2) fused with a 6xHis tag at the C-terminus.
- Formulation:
- Lyophilized from a 0.22 um filtered solution of PBS, pH 7.4.Contact us for customized product form or formulation.
- Immunogen:
- Met1-Ala161
- Physical State:
- Lyophilized
- Purity:
- ≥ 95 % as determined by SDS-PAGE;≥ 95 %
- Sequence:
- MKCTRETAMVKSLLLLMLGLAILREVAARKNPKAGVPALQKAGNCPPLEDNTVRVDIRIFNQNQGISVPREFQNRSSSPWDYNITRDPHRFPSEIAEAQCRHSGCINAQGQEDSTMNSVAIQQEILVLRREPQGCSNSFRLEKMLLKVGCTCVKPIVHQAA
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Manufacturer's Data Sheet:RP01147
