Recombinant Human FGF-10 Protein
Product Sizes
10 ug
£145.00
RP01140-10UG
20 ug
£193.00
RP01140-20UG
50 ug
£288.00
RP01140-50UG
100 ug
£431.00
RP01140-100UG
500 ug
£1240.00
RP01140-500UG
1000 ug
£1954.00
RP01140-1000UG
About this Product
- SKU:
- RP01140
- Additional Names:
- Fibroblast growth factor 10, FGF-10, Keratinocyte growth factor 2,FGF10,KGF2
- Extra Details:
- This protein is a member of the fibroblast growth factor (FGF) family. FGF family members possess broad mitogenic and cell survival activities, and are involved in a variety of biological processes, including embryonic development, cell growth, morphogenesis, tissue repair, tumor growth and invasion. This protein exhibits mitogenic activity for keratinizing epidermal cells, but essentially no activity for fibroblasts, which is similar to the biological activity of FGF7. Studies of the mouse homolog of suggested that this gene is required for embryonic epidermal morphogenesis including brain development, lung morphogenesis, and initiation of lim bud formation. This gene is also implicated to be a primary factor in the process of wound healing.
- Formulation:
- Recombinant Human FGF-10 Protein is produced by E. coli expression system. The target protein is expressed with sequence (Gln38-Ser208) of human FGF10 (Accession #NP_004456.1).
- Immunogen:
- Gln38-Ser208
- Molecular Weight:
- 20-25 kDa
- Physical State:
- Lyophilized
- Purity:
- ≥ 95 % as determined by SDS-PAGE;≥ 95 %
- Sequence:
- QALGQDMVSPEATNSSSSSFSSPSSAGRHVRSYNHLQGDVRWRKLFSFTKYFLKIEKNGKVSGTKKENCPYSILEITSVEIGVVAVKAINSNYYLAMNKKGKLYGSKEFNNDCKLKERIEENGYNTYASFNWQHNGRQMYVALNGKGAPRRGQKTRRKNTSAHFLPMVVHS
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Manufacturer's Data Sheet:RP01140
