Recombinant Human FGF-10 Protein
Product Sizes
10 ug
£145.00
RP01140-10UG
20 ug
£193.00
RP01140-20UG
50 ug
£288.00
RP01140-50UG
100 ug
£431.00
RP01140-100UG
About this Product
- SKU:
- RP01140
- Additional Names:
- Fibroblast growth factor 10, FGF-10, Keratinocyte growth factor 2,FGF10,KGF2
- Extra Details:
- Recombinant Human FGF-10 Protein is produced by E. coli expression system. The target protein is expressed with sequence (Gln38-Ser208) of human FGF10 (Accession #NP_004456.1).
- Formulation:
- Lyophilized from a 0.22 um filtered solution of PBS pH7.4.
- Immunogen:
- Gln38-Ser208
- Molecular Weight:
- 19.32 kDa
- Physical State:
- Lyophilized
- Purity:
- ≥ 95 % as determined by SDS-PAGE;≥ 95 %
- Sequence:
- QALGQDMVSPEATNSSSSSFSSPSSAGRHVRSYNHLQGDVRWRKLFSFTKYFLKIEKNGKVSGTKKENCPYSILEITSVEIGVVAVKAINSNYYLAMNKKGKLYGSKEFNNDCKLKERIEENGYNTYASFNWQHNGRQMYVALNGKGAPRRGQKTRRKNTSAHFLPMVVHS
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Manufacturer's Data Sheet:RP01140


