Recombinant Human Complement C5A Protein
Product Sizes
10 ug
£145.00
RP01128-10UG
About this Product
- SKU:
- RP01128
- Additional Names:
- C5, CPAMD4,Complement C5, C3 and PZP-like alpha-2-macroglobulin domain-containing protein 4, Cleaved into: Complement C5 beta chain, Complement C5 alpha chain, C5a anaphylatoxin, Complement C5 alpha' chain
- Extra Details:
- Recombinant Human Complement C5A Protein is produced by E. coli expression system. The target protein is expressed with sequence (Thr678-Arg751) of Human Complement C5A (Accession #NP_001726.2) fused with no tag.
- Formulation:
- Lyophilized from a 0.22 um filtered solution of PBS, pH 7.4.
- Immunogen:
- Thr678-Arg751
- Molecular Weight:
- 8.17 kDa
- Physical State:
- Lyophilized
- Purity:
- ≥90%
- Sequence:
- LQKKIEEIAAKYKHSVVKKCCYDGACVNNDETCEQRAARISLGPRCIKAFTECCVVASQLRANISHKDMQLGR
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Manufacturer's Data Sheet:RP01128
