Recombinant Human IGFBP-8/CTGF Protein
Product Sizes
10 ug
£145.00
RP01113-10UG
50 ug
£336.00
RP01113-50UG
500 ug
£2050.00
RP01113-500UG
1000 ug
£2430.00
RP01113-1000UG
About this Product
- SKU:
- RP01113
- Additional Names:
- CTGF,CCN2,HCS24,IGFBP8,NOV2
- Extra Details:
- This protein is a mitogen that is secreted by vascular endothelial cells. The encoded protein plays a role in chondrocyte proliferation and differentiation, cell adhesion in many cell types, and is related to platelet-derived growth factor. Certain polymorphisms in this gene have been linked with a higher incidence of systemic sclerosis.
- Formulation:
- Recombinant Human IGFBP-8/CTGF Protein is produced by Mammalian expression system. The target protein is expressed with sequence (Gln27-Ala180) of human CTGF (Accession #P29279) fused with no tags.
- Immunogen:
- Gln27-Ala180
- Molecular Weight:
- 16-25 kDa
- Physical State:
- Lyophilized
- Purity:
- ≥95%
- Sequence:
- QNCSGPCRCPDEPAPRCPAGVSLVLDGCGCCRVCAKQLGELCTERDPCDPHKGLFCDFGSPANRKIGVCTAKDGAPCIFGGTVYRSGESFQSSCKYQCTCLDGAVGCMPLCSMDVRLPSPDCPFPRRVKLPGKCCEEWVCDEPKDQTVVGPALA
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Manufacturer's Data Sheet:RP01113
