Recombinant Human IL-20RB Protein
Product Sizes
10 ug
£145.00
RP01102-10UG
50 ug
£288.00
RP01102-50UG
About this Product
- SKU:
- RP01102
- Additional Names:
- IL20RB,DIRS1,FNDC6,IL-20R2
- Extra Details:
- Recombinant Human IL-20RB Protein is produced by Mammalian expression system. The target protein is expressed with sequence (Asp30-Ala230) of human IL-20RB (Accession #Q6UXL0) fused with an Fc tag at the C-terminus.
- Formulation:
- Supplied as a 0.22 um filtered solution of PBS, pH 7.4.Contact us for customized product form or formulation.
- Immunogen:
- Asp30-Ala230
- Molecular Weight:
- 49.6 kda
- Purity:
- ≥95%
- Sequence:
- DEVAILPAPQNLSVLSTNMKHLLMWSPVIAPGETVYYSVEYQGEYESLYTSHIWIPSSWCSLTEGPECDVTDDITATVPYNLRVRATLGSQTSAWSILKHPFNRNSTILTRPGMEITKDGFHLVIELEDLGPQFEFLVAYWRREPGAEEHVKMVRSGGIPVHLETMEPGAAYCVKAQTFVKAIGRYSAFSQTECVEVQGEA
- Shipping Conditions:
- Dry Ice
- Storage Conditions:
- -70[o]C Aliquot. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Manufacturer's Data Sheet:RP01102
