Recombinant Human Serum amyloid A-1/SAA1 Protein
Product Sizes
10 ug
£193.00
RP01095-10UG
50 ug
£478.00
RP01095-50UG
500 ug
£2192.00
RP01095-500UG
About this Product
- SKU:
- RP01095
- Additional Names:
- SAA1,PIG4,SAA,SAA2,TP53I4
- Extra Details:
- This protein is a member of the serum amyloid A family of apolipoproteins. The encoded preproprotein is proteolytically processed to generate the mature protein. This protein is a major acute phase protein that is highly expressed in response to inflammation and tissue injury. This protein also plays an important role in HDL metabolism and cholesterol homeostasis. High levels of this protein are associated with chronic inflammatory diseases including atherosclerosis, rheumatoid arthritis, Alzheimer's disease and Crohn's disease. This protein may also be a potential biomarker for certain tumors. Alternate splicing results in multiple transcript variants that encode the same protein. A pseudogene of this gene is found on chromosome 11.
- Formulation:
- Recombinant Human Serum amyloid A-1/SAA1 Protein is produced by E. coli expression system. The target protein is expressed with sequence (Arg19-Tyr122) of human SAA1 (Accession #P0DJI8) fused with a 6
- Immunogen:
- Arg19-Tyr122
- Molecular Weight:
- 14 kDa
- Physical State:
- Lyophilized
- Purity:
- ≥95%
- Sequence:
- RSFFSFLGEAFDGARDMWRAYSDMREANYIGSDKYFHARGNYDAAKRGPGGVWAAEAISDARENIQRFFGHGAEDSLADQAADEWGRSGKDPNHFRPAGLPEKY
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Manufacturer's Data Sheet:RP01095
