Recombinant Human Serum amyloid A-1/SAA1 Protein
Product Sizes
10 ug
£193.00
RP01095-10UG
50 ug
£478.00
RP01095-50UG
About this Product
- SKU:
- RP01095
- Additional Names:
- SAA1,PIG4,SAA,SAA2,TP53I4
- Extra Details:
- Recombinant Human Serum amyloid A-1/SAA1 Protein is produced by E. coli expression system. The target protein is expressed with sequence (Arg19-Tyr122) of human SAA1 (Accession #P0DJI8) fused with a 6xHis tag at the N-terminus.
- Formulation:
- Lyophilized from a 0.22 um filtered solution of 20mM TrisHCl,150mM NaCl,1mM EDTA, pH 8.0.Contact us for customized product form or formulation.
- Immunogen:
- Arg19-Tyr122
- Molecular Weight:
- 13.2 kDa
- Physical State:
- Lyophilized
- Purity:
- ≥95%
- Sequence:
- RSFFSFLGEAFDGARDMWRAYSDMREANYIGSDKYFHARGNYDAAKRGPGGVWAAEAISDARENIQRFFGHGAEDSLADQAADEWGRSGKDPNHFRPAGLPEKY
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Manufacturer's Data Sheet:RP01095
