Recombinant Human Activin RIIA/ACVR2A Protein
Product Sizes
10 ug
£145.00
RP01094-10UG
50 ug
£336.00
RP01094-50UG
About this Product
- SKU:
- RP01094
- Additional Names:
- ACTRII, ACVR2,ACVR2A,ACVR2
- Extra Details:
- Recombinant Human Activin RIIA/ACVR2A Protein is produced by Mammalian expression system. The target protein is expressed with sequence (Ala20-Pro134) of human ACVR2A (Accession #P27037) fused with a 6xHis tag at the C-terminus.
- Formulation:
- Lyophilized from a 0.22 um filtered solution of 20mM PB, 150mM NaCl, pH 7.4.Contact us for customized product form or formulation.
- Immunogen:
- Ala20-Pro134
- Molecular Weight:
- 14.35 kDa
- Physical State:
- Lyophilized
- Purity:
- ≥95%
- Sequence:
- AILGRSETQECLFFNANWEKDRTNQTGVEPCYGDKDKRRHCFATWKNISGSIEIVKQGCWLDDINCYDRTDCVEKKDSPEVYFCCCEGNMCNEKFSYFPEMEVTQPTSNPVTPKP
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Enzymes
- Manufacturer's Data Sheet:RP01094
