Recombinant Human PMP2 Protein
Product Sizes
10 ug
£193.00
RP01086-10UG
50 ug
£478.00
RP01086-50UG
500 ug
£2050.00
RP01086-500UG
About this Product
- SKU:
- RP01086
- Additional Names:
- PMP2,FABP8,M-FABP,MP2,P2
- Extra Details:
- This protein localizes to myelin sheaths of the peripheral nervous system. The encoded protein can bind both the membrane layers of the sheaths and monomeric lipids, and is thought to provide stability to the sheath. A defect in this gene was shown to be a cause of dominant demyelinating CMT neuropathy.
- Formulation:
- Recombinant Human PMP2 Protein is produced by E. coli expression system. The target protein is expressed with sequence (Met1-Val132) of human PMP2 (Accession #P02689) fused with a 6xHis tag at the N-t
- Immunogen:
- Met1-Val132
- Molecular Weight:
- 14-20 kDa
- Physical State:
- Lyophilized
- Purity:
- ≥95%
- Sequence:
- MSNKFLGTWKLVSSENFDDYMKALGVGLATRKLGNLAKPTVIISKKGDIITIRTESTFKNTEISFKLGQEFEETTADNRKTKSIVTLQRGSLNQVQRWDGKETTIKRKLVNGKMVAECKMKGVVCTRIYEKV
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Manufacturer's Data Sheet:RP01086
