Recombinant Mouse Placenta growth factor/PlGF/PGF Protein
Product Sizes
20 ug
£223.00
RP01080-20UG
500 ug
£1478.00
RP01080-500UG
1000 ug
£2335.00
RP01080-1000UG
About this Product
- SKU:
- RP01080
- Additional Names:
- PGF,PLGF,PlGF2,PlGF,PGFL,SHGC-10760,PGF
- Extra Details:
- Placenta growth factor (PlGF) is a member of the PDGF/VEGF family of growth factors that share a conserved pattern of eight cysteines. Alternative splicing results in at least three human mature PlGF forms containing 131 (PlGF-1), 152 (PlGF-2), and 203 (PlGF-3) amino acids (aa) respectively. Only PlGF-2 contains a highly basic heparin-binding 21 aa insert at the C-terminus. Human PlGF-1 shares 56%, 55%, 74% and 95% aa identity with the comparable isoform of mouse, rat, canine, and equine PlGF, respectively. PlGF is mainly found as variably glycosylated, secreted, 55-60 kDa disulfide linked homodimers. Mammalian cells expressing PlGF include villous trophoblasts, decidual cells, erythroblasts, keratinocytes, and some endothelial cells. Circulating PlGF increases during pregnancy, reaching a peak in mid-gestation; this increase is attenuated in preeclampsia. However, deletion of PlGF in the mouse does not affect development or reproduction. Postnatally, mice lacking PlGF show impaired angiogenesis in response to ischemia.
- Formulation:
- Recombinant Mouse Placenta growth factor/PlGF/PGF Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Met1-Pro158) of mouse PLGF/PGF (Accession #NP_03
- Immunogen:
- Met1-Pro158
- Molecular Weight:
- 60 kda
- Physical State:
- Lyophilized
- Purity:
- ≥85%
- Sequence:
- MLVMKLFTCFLQVLAGLAVHSQGALSAGNNSTEVEVVPFNEVWGRSYCRPMEKLVYILDEYPDEVSHIFSPSCVLLSRCSGCCGDEGLHCVPIKTANITMQILKIPPNRDPHFYVEMTFSQDVLCECRPILETTKAERRKTKGKRKRSRNSQTEEPHP
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Manufacturer's Data Sheet:RP01080
