Recombinant Mouse Placenta growth factor/PlGF/PGF Protein
Product Sizes
20 ug
£223.00
RP01080-20UG
About this Product
- SKU:
- RP01080
- Additional Names:
- PGF,PLGF,PlGF2,PlGF,PGFL,SHGC-10760,PGF
- Extra Details:
- Recombinant Mouse Placenta growth factor/PlGF/PGF Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Met1-Pro158) of mouse PLGF/PGF (Accession #NP_032853.1) fused with an Fc, 6xHis tag at the C-terminus.
- Formulation:
- Lyophilized from a 0.22 um filtered solution of PBS, pH 7.4.Contact us for customized product form or formulation.
- Immunogen:
- Met1-Pro158
- Molecular Weight:
- 44.66 kDa
- Physical State:
- Lyophilized
- Purity:
- ≥85%
- Sequence:
- MLVMKLFTCFLQVLAGLAVHSQGALSAGNNSTEVEVVPFNEVWGRSYCRPMEKLVYILDEYPDEVSHIFSPSCVLLSRCSGCCGDEGLHCVPIKTANITMQILKIPPNRDPHFYVEMTFSQDVLCECRPILETTKAERRKTKGKRKRSRNSQTEEPHP
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Manufacturer's Data Sheet:RP01080
