Recombinant Mouse IL-21R/CD360 Protein
Product Sizes
10 ug
£133.00
RP01079-10UG
20 ug
£181.00
RP01079-20UG
50 ug
£240.00
RP01079-50UG
100 ug
£353.00
RP01079-100UG
About this Product
- SKU:
- RP01079
- Additional Names:
- CD360,NILR,IL-21 R,IL-21 receptor,IL21R,IL-21R,interleukin 21 receptor,interleukin-21 receptor, IL21R
- Extra Details:
- Recombinant Mouse IL-21R/CD360 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Cys20-Pro236) of mouse IL-21R/Interleukin-21 Receptor (Accession #NP_068687.1) fused with a 6xHis tag at the C-terminus.
- Formulation:
- Lyophilized from a 0.22 um filtered solution of PBS, pH 7.4.Contact us for customized product form or formulation.
- Immunogen:
- Cys20-Pro236
- Molecular Weight:
- 25.73 kDa
- Physical State:
- Lyophilized
- Purity:
- ≥ 95 % as determined by SDS-PAGE;≥ 90 %
- Sequence:
- CLDLTCYTDYLWTITCVLETRSPNPSILSLTWQDEYEELQDQETFCSLHRSGHNTTHIWYTCHMRLSQFLSDEVFIVNVTDQSGNNSQECGSFVLAESIKPAPPLNVTVAFSGRYDISWDSAYDEPSNYVLRGKLQYELQYRNLRDPYAVRPVTKLISVDSRNVSLLPEEFHKDSSYQLQVRAAPQPGTSFRGTWSEWSDPVIFQTQAGEPEAGWDP
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Manufacturer's Data Sheet:RP01079
