Recombinant Mouse IFN-beta Protein
Product Sizes
10 ug
£145.00
RP01076-10UG
20 ug
£193.00
RP01076-20UG
50 ug
£288.00
RP01076-50UG
100 ug
£431.00
RP01076-100UG
500 ug
£1240.00
RP01076-500UG
1000 ug
£1954.00
RP01076-1000UG
About this Product
- SKU:
- RP01076
- Additional Names:
- Fibroblast interferon,IFBIFNB,IFF,IFNB1,IFNbeta,IFN-beta,interferon beta, IFNB
- Extra Details:
- Recombinant Mouse IFN-beta Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Ile22-Asn182) of mouse Interferon beta (Accession #NP_034640.1) fused with an Fc, 6xHis tag at the C-terminus.
- Formulation:
- Recombinant Mouse IFN-beta Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Ile22-Asn182) of mouse Interferon beta (Accession #NP_034640.1) fused w
- Immunogen:
- Ile22-Asn182
- Molecular Weight:
- 60 kda
- Physical State:
- Lyophilized
- Purity:
- ≥ 90 % as determined by SDS-PAGE;≥ 90 %
- Sequence:
- INYKQLQLQERTNIRKCQELLEQLNGKINLTYRADFKIPMEMTEKMQKSYTAFAIQEMLQNVFLVFRNNFSSTGWNETIVVRLLDELHQQTVFLKTVLEEKQEERLTWEMSSTALHLKSYYWRVQRYLKLMKYNSYAWMVVRAEIFRNFLIIRRLTRNFQN
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Manufacturer's Data Sheet:RP01076
