Recombinant Rat IFN-gamma Protein
Product Sizes
10 ug
£133.00
RP01075-10UG
20 ug
£181.00
RP01075-20UG
50 ug
£240.00
RP01075-50UG
100 ug
£353.00
RP01075-100UG
500 ug
£1240.00
RP01075-500UG
1000 ug
£1954.00
RP01075-1000UG
About this Product
- SKU:
- RP01075
- Additional Names:
- IFN-gamma,Interferon Gamma,IFNG
- Extra Details:
- Interferon-gamma (IFN-gamma ) is a secreted protein which belongs to the type II interferon family. IFN-gamma is produced by a variety of immune cells under inflammatory conditions, notably by T cells and NK cells. IFN-gamma, in addition to having antiviral activity, has important immunoregulatory functions. Interferon-gamma is a central regulator of the immune response and signals via the Janus Activated Kinase (JAK)-Signal Transducer and Activator of Transcription (STAT) pathway.
- Formulation:
- Recombinant Rat IFN-gamma Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Gln23-Cys156) of rat Interferon Gamma (Accession #NP_620235.1) fused wit
- Immunogen:
- Gln23-Cys156
- Molecular Weight:
- 50-55 kDa
- Physical State:
- Lyophilized
- Purity:
- ≥90%
- Sequence:
- QGTLIESLESLKNYFNSSSMDAMEGKSLLLDIWRNWQKDGNTKILESQIISFYLRLFEVLKDNQAISNNISVIESHLITNFFSNSKAKKDAFMSIAKFEVNNPQIQHKAVNELIRVIHQLSPESSLRKRKRSRC
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Manufacturer's Data Sheet:RP01075
