Recombinant Rat IFN-gamma Protein
Product Sizes
10 ug
£133.00
RP01075-10UG
20 ug
£181.00
RP01075-20UG
50 ug
£240.00
RP01075-50UG
100 ug
£353.00
RP01075-100UG
About this Product
- SKU:
- RP01075
- Additional Names:
- IFN-gamma,Interferon Gamma,IFNG
- Extra Details:
- Recombinant Rat IFN-gamma Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Gln23-Cys156) of rat Interferon Gamma (Accession #NP_620235.1) fused with an Fc, 6xHis tag at the C-terminus.
- Formulation:
- Lyophilized from a 0.22 um filtered solution of PBS, pH 7.4.Contact us for customized product form or formulation.
- Immunogen:
- Gln23-Cys156
- Molecular Weight:
- 42.29 kDa
- Physical State:
- Lyophilized
- Purity:
- ≥90%
- Sequence:
- QGTLIESLESLKNYFNSSSMDAMEGKSLLLDIWRNWQKDGNTKILESQIISFYLRLFEVLKDNQAISNNISVIESHLITNFFSNSKAKKDAFMSIAKFEVNNPQIQHKAVNELIRVIHQLSPESSLRKRKRSRC
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Manufacturer's Data Sheet:RP01075
