Recombinant Rat CCL2/MCP-1 Protein
Product Sizes
20 ug
£223.00
RP01073-20UG
50 ug
£336.00
RP01073-50UG
100 ug
£508.00
RP01073-100UG
About this Product
- SKU:
- RP01073
- Additional Names:
- C-C motif chemokine ligand 2,CCL2,GDCF-2,HC11,HSMCR30,MCAF,Mcp1,MCP-1,SCYA2,SMC-CF,Ccl2/MCP1
- Extra Details:
- Recombinant Rat CCL2/MCP-1 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Gln24-Asn148) of rat CCL2/JE/MCP-1 (Accession #NP_113718.1.) fused with a 6xHis tag at the C-terminus.
- Formulation:
- Lyophilized from a 0.22 um filtered solution of PBS, pH 7.4.Contact us for customized product form or formulation.
- Immunogen:
- Gln24-Asn148
- Molecular Weight:
- 14.91 kDa
- Physical State:
- Lyophilized
- Purity:
- ≥95%
- Sequence:
- QPDAVNAPLTCCYSFTGKMIPMSRLENYKRITSSRCPKEAVVFVTKLKREICADPNKEWVQKYIRKLDQNQVRSETTVFYKIASTLRTSAPLNVNLTHKSEANASTLFSTTTSSTSVEVTSMTEN
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Manufacturer's Data Sheet:RP01073




