Recombinant Mouse TNF-alpha Protein
Product Sizes
10 ug
£145.00
RP01071-10UG
20 ug
£193.00
RP01071-20UG
50 ug
£288.00
RP01071-50UG
100 ug
£431.00
RP01071-100UG
500 ug
£1240.00
RP01071-500UG
1000 ug
£1954.00
RP01071-1000UG
About this Product
- SKU:
- RP01071
- Additional Names:
- DIF, Tnfa, TNF-a, TNFSF2, Tnlg1f, Tnfsf1a, TNFalpha, TNF-alpha,TNF
- Extra Details:
- Recombinant Mouse TNF-alpha Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Leu80-Leu235) of mouse TNF-alpha (Accession #NP_038721.1) fused with a 6xHis tag at the C-terminus.
- Formulation:
- Recombinant Mouse TNF-alpha Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Leu80-Leu235) of mouse TNF-alpha (Accession #NP_038721.1) fused with a
- Immunogen:
- Leu80-Leu235
- Molecular Weight:
- 18 kDa
- Physical State:
- Lyophilized
- Purity:
- ≥ 95 % as determined by SDS-PAGE;≥95 %
- Sequence:
- LRSSSQNSSDKPVAHVVANHQVEEQLEWLSQRANALLANGMDLKDNQLVVPADGLYLVYSQVLFKGQGCPDYVLLTHTVSRFAISYQEKVNLLSAVKSPCPKDTPEGAELKPWYEPIYLGGVFQLEKGDQLSAEVNLPKYLDFAESGQVYFGVIAL
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Manufacturer's Data Sheet:RP01071
