Recombinant Mouse IFN-gamma Protein
Product Sizes
20 ug
£145.00
RP01070-20UG
50 ug
£193.00
RP01070-50UG
100 ug
£276.00
RP01070-100UG
About this Product
- SKU:
- RP01070
- Additional Names:
- IFG,IFI,IFN gamma,Interferon Gamma,IFNG
- Extra Details:
- Recombinant Mouse IFN-gamma Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Met1-Cys155) of mouse Interferon Gamma (Accession #NP_032363.1) fused with an Fc, 6xHis tag at the C-terminus.
- Formulation:
- Lyophilized from a 0.22 um filtered solution of PBS, pH 7.4.Contact us for customized product form or formulation.
- Immunogen:
- Met1-Cys155
- Molecular Weight:
- 44.70 kDa
- Physical State:
- Lyophilized
- Purity:
- ≥ 90 % as determined by SDS-PAGE;≥ 90 %
- Sequence:
- MNATHCILALQLFLMAVSGCYCHGTVIESLESLNNYFNSSGIDVEEKSLFLDIWRNWQKDGDMKILQSQIISFYLRLFEVLKDNQAISNNISVIESHLITTFFSNSKAKKDAFMSIAKFEVNNPQVQRQAFNELIRVVHQLLPESSLRKRKRSRC
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Manufacturer's Data Sheet:RP01070










