Recombinant Human BTN3A1/CD277 Protein
Product Sizes
10 ug
£133.00
RP01067-10UG
20 ug
£181.00
RP01067-20UG
50 ug
£240.00
RP01067-50UG
100 ug
£353.00
RP01067-100UG
About this Product
- SKU:
- RP01067
- Additional Names:
- BTN3A1,BT3.1,BTF5,BTN3.1,CD277
- Extra Details:
- Recombinant human BTN3A1/CD277 Protein is produced by HEK293 expression system. The target protein is expressed with sequence (Gln30-Gly254) of human BTN3A1/CD277 (Accession #NP_919423.1) fused with an Fc, 6xHis tag at the C-terminus.
- Formulation:
- Lyophilized from a 0.22 um filtered solution of PBS, pH 7.4.Contact us for customized product form or formulation.
- Immunogen:
- Gln30-Gly254
- Molecular Weight:
- 50.94 kDa
- Physical State:
- Lyophilized
- Purity:
- ≥95%
- Sequence:
- QFSVLGPSGPILAMVGEDADLPCHLFPTMSAETMELKWVSSSLRQVVNVYADGKEVEDRQSAPYRGRTSILRDGITAGKAALRIHNVTASDSGKYLCYFQDGDFYEKALVELKVAALGSDLHVDVKGYKDGGIHLECRSTGWYPQPQIQWSNNKGENIPTVEAPVVADGVGLYAVAASVIMRGSSGEGVSCTIRSSLLGLEKTASISIADPFFRSAQRWIAALAG
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Manufacturer's Data Sheet:RP01067
