Recombinant Mouse Lipocalin-2/NGAL/LCN2 Protein
Product Sizes
10 ug
£127.00
RP01064-10UG
20 ug
£157.00
RP01064-20UG
50 ug
£223.00
RP01064-50UG
100 ug
£336.00
RP01064-100UG
About this Product
- SKU:
- RP01064
- Additional Names:
- NGAL,LCN2,Lipocalin-2,24p3,MSFI,LCN2
- Extra Details:
- Recombinant Mouse Lipocalin-2/NGAL Protein is produced by HEK293 expression system. The target protein is expressed with sequence (Gln21-Asn200) of mouse Lipocalin-2/NGAL (Accession #NP_032517.1) fused with an 8xHis tag at the C-terminus.
- Formulation:
- Lyophilized from a 0.22 um filtered solution of PBS, pH 7.4.Contact us for customized product form or formulation.
- Immunogen:
- Gln21-Asn200
- Molecular Weight:
- 21.71 kDa
- Physical State:
- Lyophilized
- Purity:
- ≥95%
- Sequence:
- QDSTQNLIPAPSLLTVPLQPDFRSDQFRGRWYVVGLAGNAVQKKTEGSFTMYSTIYELQENNSYNVTSILVRDQDQGCRYWIRTFVPSSRAGQFTLGNMHRYPQVQSYNVQVATTDYNQFAMVFFRKTSENKQYFKITLYGRTKELSPELKERFTRFAKSLGLKDDNIIFSVPTDQCIDN
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Manufacturer's Data Sheet:RP01064
