Recombinant Mouse Dkk-1 Protein
Product Sizes
10 ug
£163.00
RP01062-10UG
20 ug
£223.00
RP01062-20UG
50 ug
£336.00
RP01062-50UG
2 x 50 ug
£508.00
RP01062-2X50UG
About this Product
- SKU:
- RP01062
- Additional Names:
- DKK1,SK,Dickkopf-1,DKK1,DKK1,SK,DKK1
- Extra Details:
- Recombinant Mouse Dkk-1 Protein is produced by HEK293 expression system. The target protein is expressed with sequence (Met1-His272) of mouse Dkk-1 (Accession #NP_034181.2. ) fused with a 6xHis tag at the C-terminus.
- Formulation:
- Lyophilized from a 0.22 um filtered solution of PBS, pH 7.4.Contact us for customized product form or formulation.
- Immunogen:
- Met1-His272
- Molecular Weight:
- 30.13 kDa
- Physical State:
- Lyophilized
- Purity:
- ≥85%
- Sequence:
- MMVVCAAAAVRFLAVFTMMALCSLPLLGASATLNSVLINSNAIKNLPPPLGGAGGQPGSAVSVAPGVLYEGGNKYQTLDNYQPYPCAEDEECGSDEYCSSPSRGAAGVGGVQICLACRKRRKRCMRHAMCCPGNYCKNGICMPSDHSHFPRGEIEESIIENLGNDHNAAAGDGYPRRTTLTSKIYHTKGQEGSVCLRSSDCAAGLCCARHFWSKICKPVLKEGQVCTKHKRKGSHGLEIFQRCYCGEGLACRIQKDHHQASNSSRLHTCQRH
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Manufacturer's Data Sheet:RP01062
