Recombinant Mouse CXCL16/SR-PSOX Protein
Product Sizes
20 ug
£193.00
RP01061-20UG
50 ug
£288.00
RP01061-50UG
About this Product
- SKU:
- RP01061
- Additional Names:
- CXCL16,CXCLG16,SCYB16,SR-PSOX,CXCL16
- Extra Details:
- Recombinant Mouse CXCL16/SR-PSOX Protein is produced by HEK293 expression system. The target protein is expressed with sequence (Asn27-Trp201) of mouse CXCL16 (Accession #NP_075647.3) fused with a 6xHis tag at the C-terminus.
- Formulation:
- Lyophilized from a 0.22 um filtered solution of PBS, pH 7.4.Contact us for customized product form or formulation.
- Immunogen:
- Asn27-Trp201
- Molecular Weight:
- 19.92 kDa
- Physical State:
- Lyophilized
- Purity:
- ≥95%
- Sequence:
- NQGSVAGSCSCDRTISSGTQIPQGTLDHIRKYLKAFHRCPFFIRFQLQSKSVCGGSQDQWVRELVDCFERKECGTGHGKSFHHQKHLPQASTQTPEAAEGTPSDTSTPAHSQSTQHSTLPSGALSLNKEHTQPWEMTTLPSGYGLEARPEAEANEKQQDDRQQEAPGAGASTPAW
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Manufacturer's Data Sheet:RP01061
