Recombinant Mouse c-Kit ligand/KITLG/SCF Protein
Product Sizes
10 ug
£145.00
RP01055-10UG
20 ug
£193.00
RP01055-20UG
50 ug
£288.00
RP01055-50UG
100 ug
£431.00
RP01055-100UG
About this Product
- SKU:
- RP01055
- Additional Names:
- KITLG,FPH2,KL-1,Kitl,MGF,SCF,SF,SHEP7,KL,SCF/KITLG
- Extra Details:
- Recombinant Mouse c-Kit ligand/KITLG/SCF Protein is produced by HEK293 expression system. The target protein is expressed with sequence (Lys26-Ala189) of mouse SCF (Accession #NP_038626.1.) fused with a 6xHis tag at the C-terminus.
- Formulation:
- Lyophilized from a 0.22 um filtered solution of PBS, pH 7.4.Contact us for customized product form or formulation.
- Immunogen:
- Lys26-Ala189
- Molecular Weight:
- 19.14 kDa
- Physical State:
- Lyophilized
- Purity:
- ≥ 95 % as determined by SDS-PAGE;≥ 95 %
- Sequence:
- KEICGNPVTDNVKDITKLVANLPNDYMITLNYVAGMDVLPSHCWLRDMVIQLSLSLTTLLDKFSNISEGLSNYSIIDKLGKIVDDLVLCMEENAPKNIKESPKRPETRSFTPEEFFSIFNRSIDAFKDFMVASDTSDCVLSSTLGPEKDSRVSVTKPFMLPPVA
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Manufacturer's Data Sheet:RP01055
