Recombinant Human BTLA/CD272 Protein
Product Sizes
10 ug
£133.00
RP01052-10UG
20 ug
£181.00
RP01052-20UG
50 ug
£240.00
RP01052-50UG
100 ug
£353.00
RP01052-100UG
About this Product
- SKU:
- RP01052
- Additional Names:
- BTLA,BTLA1,CD272
- Extra Details:
- Active Recombinant Human BTLA Protein is produced by HEK293 expression system. The target protein is expressed with sequence (Lys31-Thr134) of human BTLA (Accession #NP_001078826.1.) fused with an Fc, 6xHis tag at the C-terminus.
- Formulation:
- Lyophilized from a 0.22 um filtered solution of PBS, pH 7.4.Contact us for customized product form or formulation.
- Immunogen:
- Lys31-Thr134
- Molecular Weight:
- 38.81 kDa
- Physical State:
- Lyophilized
- Purity:
- ≥90%
- Sequence:
- KESCDVQLYIKRQSEHSILAGDPFELECPVKYCANRPHVTWCKLNGTTCVKLEDRQTSWKEEKNISFFILHFEPVLPNDNGSYRCSANFQSNLIESHSTTLYVT
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Manufacturer's Data Sheet:RP01052
