Recombinant Human 12E7/MIC2 /CD99 Protein
Product Sizes
10 ug
£133.00
RP01050-10UG
20 ug
£181.00
RP01050-20UG
50 ug
£240.00
RP01050-50UG
100 ug
£353.00
RP01050-100UG
About this Product
- SKU:
- RP01050
- Additional Names:
- CD99, HBA71, MIC2, MIC2X, MIC2Y, MSK5X, CD99 antigen,HBA71,MIC2,MIC2X,MIC2Y,MSK5X
- Extra Details:
- Recombinant Human 12E7/MIC2 /CD99 Protein is produced by HEK293 expression system. The target protein is expressed with sequence (Asp23-Asp122) of human CD99 (Accession #NP_002405.1.) fused with an Fc, 6xHis tag at the C-terminus.
- Formulation:
- Lyophilized from a 0.22 um filtered solution of PBS, pH 7.4.Contact us for customized product form or formulation.
- Immunogen:
- Asp23-Asp122
- Molecular Weight:
- 36.88 kDa
- Physical State:
- Lyophilized
- Purity:
- ≥85%
- Sequence:
- DGGFDLSDALPDNENKKPTAIPKKPSAGDDFDLGDAVVDGENDDPRPPNPPKPMPNPNPNHPSSSGSFSDADLADGVSGGEGKGGSDGGGSHRKEGEEAD
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Manufacturer's Data Sheet:RP01050
